Rabbit Polyclonal Antibody to IL-1 beta

Description
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Specification
Aliases	IL1B; IL1F2; Interleukin-1 beta; IL-1 beta; Catabolin
Entrez GeneID	3553
Swissprot	P01584
WB Predicted band size	Calculated MW: 31 kDa; Observed MW: 31 kDa
Host/Isotype	Rabbit IgG
Antibody Type	Primary antibody
Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Species Reactivity	Human,Mouse,Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 124-223 of human IL1B (NP_000567.1).CTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEIN
Formulation	Purified antibody in PBS with 0.05% sodium azide,0.5%BSA and 50% glycerol.

Application
WB	1/500-1/1000